DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG30187

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:231 Identity:62/231 - (26%)
Similarity:96/231 - (41%) Gaps:62/231 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSIIGHTWVITAAHC---------THGAHS----------VTIYYGALWRLQAQYTHTVGSGH 116
            |||::|...:|:|||||         :.||::          :|....:.:.::|.|.:.:|.  
  Fly    61 CGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYNKSDPADRKDVITAVVHSSFDVRASYENDIGL-- 123

  Fly   117 FRQHSDYNTNNLNNDISLINTPHVDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVS 181
            .:..||...|.|...|.::          :|| .:.:......:|.     |.||| .......|
  Fly   124 LKLSSDVIFNALIRPICIV----------LNK-SMANHMRNMRTFK-----AFGWG-TLRGNKTS 171

  Fly   182 DYLNCVDSQIITRDEC---SSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLV-------LHDRS 236
            |.|..:....:.|:||   .|||.    ::..||...|.| .||.|||||||.       :.:|.
  Fly   172 DILQTIILNHLDREECYMELSVYP----SEKQICAGVPSG-DTCGGDSGGPLTNDVFIQGIGNRE 231

  Fly   237 KLVGVTSFVAASGCTSGLPDG---FTRVTSYLDWIR 269
            ...|:.| |..:.|     ||   :|.:.|:.|||:
  Fly   232 VQFGIIS-VGKTSC-----DGQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 60/228 (26%)
Tryp_SPc 43..271 CDD:238113 62/231 (27%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 60/228 (26%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.