DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG30087

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:263 Identity:67/263 - (25%)
Similarity:102/263 - (38%) Gaps:67/263 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTH-------GAHSV----- 94
            |:.||..|.....|::|   :.:::....|||||:...:::|||||..       |.|::     
  Fly    41 RVVNGKEAVIRSAPFMV---YVTNNSLTHCGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPD 102

  Fly    95 ---------TIYYGALWRLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLIN-------TPHVD-F 142
                     :..||.:..:              .|..||..|..|||:|:.       ..|:. .
  Fly   103 CQGSNCSPRSEEYGIMKAI--------------THRFYNAANHVNDIALLKLNRSINFNVHIQPI 153

  Fly   143 WHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVIT 207
            ..|:|....|       |.|.:...  |||....: |....|...:.:......||..:.. .:.
  Fly   154 CILLNPASAP-------SVATYQTF--GWGETKKN-GFPHLLQTAELRAYDAAYCSRSFHA-YMN 207

  Fly   208 DNVICTSTPGGKSTCAGDSGGPLVLH------DRSKLVGVTSFVAASGCTSGLPDGFTRVTSYLD 266
            .|.||.... .:.|||||||||||..      .|...:|:.|: ..:.|.|  |..:|.|.:|::
  Fly   208 GNQICAGHE-ERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSY-GPTDCQS--PGVYTYVPNYIN 268

  Fly   267 WIR 269
            |||
  Fly   269 WIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 64/260 (25%)
Tryp_SPc 43..271 CDD:238113 66/262 (25%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 64/260 (25%)
Tryp_SPc 42..272 CDD:238113 66/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.