DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Cela1

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:265 Identity:78/265 - (29%)
Similarity:117/265 - (44%) Gaps:65/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWW--CGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRL 104
            |:..|..|.....|..:.|.:.| .|.|:  |||::|...||:|||||...              
  Rat    26 RVVGGAEARRNSWPSQISLQYLS-GGSWYHTCGGTLIRRNWVMTAAHCVSS-------------- 75

  Fly   105 QAQYTHTVGSGHFRQ---------------HSDYNTNNL--NNDISLIN-TPHVDFWHLINKVEL 151
            |..:...||..:..|               |.::|:||:  ..||:|:. ...|...:.:....|
  Rat    76 QMTFRVVVGDHNLSQNDGTEQYVSVQKIVVHPNWNSNNVAAGYDIALLRLAQSVTLNNYVQLAVL 140

  Fly   152 P-DGNERHDSFAGWWALA-------SGWGRPCDSCGVSD-----YLNCVDSQIITRDECSSVYGT 203
            | :|.          .||       :||||...:..:|.     ||..||..|.:   .||.:|:
  Rat   141 PQEGT----------ILANNNPCYITGWGRTRTNGQLSQTLQQAYLPSVDYSICS---SSSYWGS 192

  Fly   204 DVITDNVICTSTPGGKSTCAGDSGGPL--VLHDRSKLVGVTSFVAASGC-TSGLPDGFTRVTSYL 265
            .|.| .::|....|.:|.|.|||||||  :::.:..:.||||||::.|| .|..|..||||::|:
  Rat   193 TVKT-TMVCAGGDGVRSGCQGDSGGPLHCLVNGQYSVHGVTSFVSSMGCNVSRKPTVFTRVSAYI 256

  Fly   266 DWIRD 270
            .|:.:
  Rat   257 SWMNN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 77/261 (30%)
Tryp_SPc 43..271 CDD:238113 77/264 (29%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 77/260 (30%)
Tryp_SPc 27..262 CDD:238113 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.