DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and TPSD1

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:253 Identity:68/253 - (26%)
Similarity:102/253 - (40%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFLTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSG 67
            |.|.:||:.:   .|.|..|.|.|        |....:..|..|..|...|.|:.|.|..   .|
Human     9 LSLLLLALPV---LASPAYVAPAP--------GQALQQTGIVGGQEAPRSKWPWQVSLRV---RG 59

  Fly    68 GWW---CGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYTHTVGSGHFRQ---------- 119
            .:|   ||||:|...||:|||||.    ...|...|..|:|.:..|.    :::.          
Human    60 PYWMHFCGGSLIHPQWVLTAAHCV----EPDIKDLAALRVQLREQHL----YYQDQLLPVSRIIV 116

  Fly   120 HSDYNTNNLNNDISLINTPH-VDFWHLINKVELPDGNERHDSFAGWWALASGWGRPCDSCGV-SD 182
            |..:.......||:|:.... |:....|:.|.||..:|........|  .:|||...::..: ..
Human   117 HPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCW--VTGWGDVDNNVHLPPP 179

  Fly   183 Y-LNCVDSQIITRDECSSVYGT--------DVITDNVICTSTPGGKSTCAGDSGGPLV 231
            | |..|:..::....|::.|.|        .::.|:::|..:....| |.||||||||
Human   180 YPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDS-CQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 58/214 (27%)
Tryp_SPc 43..271 CDD:238113 58/213 (27%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 58/213 (27%)
Tryp_SPc 38..240 CDD:214473 58/213 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.