DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and try-10

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:238 Identity:58/238 - (24%)
Similarity:88/238 - (36%) Gaps:60/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQAQYT--------HTVGSGHFRQHS------ 121
            |||.:|..:.|||:|||        ::.|..:.:.|:.|        |..|...||.|:      
 Worm   104 CGGVLIAPSIVITSAHC--------VFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKK 160

  Fly   122 DYN-TNNLNNDISLINTP-HVDFWH---LINKVELPD-GNERHDSFAGWWAL--------ASGWG 172
            .:| .:..|:|:::|..| ..|..|   .:...:||. |:......|....|        .:|||
 Worm   161 FFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSVCYVAGWG 225

  Fly   173 RPCD-SCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLVLHDRS 236
            :..: :...||.:..:...:..|......|        :|..:..|....|.||||.|:......
 Worm   226 KTENKTAKYSDSVRQMMVNLSVRRIGKRKY--------LIAKAVTGSSRACMGDSGSPVYCFVNG 282

  Fly   237 K--LVGVTSFVAASGCTSGLPD-------GFTRVTSYL---DW 267
            |  |||.   ||..|..|.:.:       .|.|...|.   ||
 Worm   283 KRILVGT---VAHIGSFSKMSEQDPSNHISFCRDFEYTFVSDW 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 58/238 (24%)
Tryp_SPc 43..271 CDD:238113 58/238 (24%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.