DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CTRL

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:260 Identity:85/260 - (32%)
Similarity:125/260 - (48%) Gaps:36/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLGSGSG----------SIEGRITNGYPAYEGKVPYIVGLGFSSDSGGW-WCGGSIIGHTWVITA 84
            :|||..|          |...||.||..|..|..|:.|.|   .||.|: :||||:|..:||:||
Human    12 LLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL---QDSSGFHFCGGSLISQSWVVTA 73

  Fly    85 AHC--THGAHSVTIYYGALWR-LQAQYTHTVGSGHFRQHSDYNTNNLNNDISLIN--TPHVDFWH 144
            |||  :.|.|.|.:  |...| ..|:....:.......|..:|:..:|||::|:.  :| ..:..
Human    74 AHCNVSPGRHFVVL--GEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASP-AQYTT 135

  Fly   145 LINKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSD----YLNCVDSQIITRDECSSVYGTDV 205
            .|:.|.|...||....  |...:.:||||   ..||.:    :|..|...::|.::|...:|:. 
Human   136 RISPVCLASSNEALTE--GLTCVTTGWGR---LSGVGNVTPAHLQQVALPLVTVNQCRQYWGSS- 194

  Fly   206 ITDNVICTSTPGGKSTCAGDSGGPLVLHDRSK--LVGVTSFVAASGCTSGLPDGFTRVTSYLDWI 268
            |||::||.. ..|.|:|.||||||||....:.  |:|:.|: ....|....|..:|||:.:..||
Human   195 ITDSMICAG-GAGASSCQGDSGGPLVCQKGNTWVLIGIVSW-GTKNCNVRAPAVYTRVSKFSTWI 257

  Fly   269  268
            Human   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 78/237 (33%)
Tryp_SPc 43..271 CDD:238113 79/238 (33%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 79/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.