DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG43742

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:252 Identity:69/252 - (27%)
Similarity:111/252 - (44%) Gaps:57/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGA------ 100
            |:.||:.|...:  ::..|..:|:   ::||||:|...:|:|||||......||::.|.      
  Fly    34 RVANGHTAITSQ--FMAALYNNSE---FFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCP 93

  Fly   101 ------LWRLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLIN-------TPHVDFWHLINKVELP 152
                  :.||.|:..         .|.:::.|...|||:|:.       ..|:....:|...::.
  Fly    94 IPVCKHVLRLNAKVI---------LHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVT 149

  Fly   153 DGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPG 217
            ..|:.:.:       |.|||: .:...:||.|:.:|...:.:..|..       ..|.||..:..
  Fly   150 SNNQNNFT-------AYGWGK-TEHGNISDVLSFIDLVRLPKSMCYQ-------NINTICAGSTS 199

  Fly   218 GKSTCAGDSGGPLV---LH---DRSKLVGVTSFVAASGCTSGLPDGFTRVTSYLDWI 268
            | .||..||||||:   :|   .|..|.|:||:..|. | |||...:|.|.:|..||
  Fly   200 G-DTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAE-C-SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 67/250 (27%)
Tryp_SPc 43..271 CDD:238113 68/251 (27%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 67/250 (27%)
Tryp_SPc 35..256 CDD:238113 68/251 (27%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.