DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG43336

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:259 Identity:77/259 - (29%)
Similarity:104/259 - (40%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAAHCTHGAHSVTIYYGALWRLQA 106
            |:.||..|.....|::..|  .|..|.:.||||:|.:..|:|||||......:....|...|.:.
  Fly    37 RVKNGTVASLTSSPWMAFL--HSTDGRFICGGSLITNRLVLTAAHCFLDRTELVARLGEYDREEY 99

  Fly   107 QYTH----------TVGSGHFRQHSDYNTNNLNNDISLINTPHVDFWHLINKVELPDGNERH--- 158
            :..|          .|..| || |..||...:..||:::        .|..||:..| |.|.   
  Fly   100 EMCHDSYCTYRIEAMVERG-FR-HRHYNPMTMAYDIAIL--------RLYRKVQYTD-NIRPICI 153

  Fly   159 -------------DSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNV 210
                         |...|     :|||: .:|.|.|..|..||......:.|.. |.|..:|.|.
  Fly   154 VIDPRWRKYIDSLDPLTG-----TGWGK-TESEGDSAKLRTVDLARKHPEVCRR-YATLSLTANQ 211

  Fly   211 ICTSTPGGKSTCAGDSGGP---LVLHDRSK---LVGVTSFVAASGCTSGLPDGFTRVTSYLDWI 268
            .|.... ..:.|.||||||   |:.:.:||   .||:.||.... |.  :...||.|.||:|||
  Fly   212 FCAGNE-RSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQ-CV--MVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 75/257 (29%)
Tryp_SPc 43..271 CDD:238113 76/258 (29%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 75/257 (29%)
Tryp_SPc 40..271 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435706
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.