DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and Ctrl

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:259 Identity:85/259 - (32%)
Similarity:122/259 - (47%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLGSGSG----------SIEGRITNGYPAYEGKVPYIVGLGFSSDSGGWWCGGSIIGHTWVITAA 85
            :|||..|          |...||.||..|..|..|:.|.|  ..::|..:||||:|...||:|||
Mouse    12 LLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSL--QDNTGFHFCGGSLISPNWVVTAA 74

  Fly    86 HC--THGAHSVTIYYGALWR-LQAQYTHTVGSGHFRQHSDYNTNNLNNDISLIN--TPHVDFWHL 145
            ||  |.|.|.|.:  |...| ..|:....:.......|.::|.|.:|||::|:.  :| ..:...
Mouse    75 HCQVTPGRHFVVL--GEYDRSSNAEPVQVLSIARAITHPNWNANTMNNDLTLLKLASP-ARYTAQ 136

  Fly   146 INKVELPDGNERHDSFAGWWALASGWGRPCDSCGVSDY----LNCVDSQIITRDECSSVYGTDVI 206
            ::.|.|...||...|  |...:.:||||   ..||.:.    |..|...::|.::|...:|.. |
Mouse   137 VSPVCLASTNEALPS--GLTCVTTGWGR---ISGVGNVTPARLQQVVLPLVTVNQCRQYWGAR-I 195

  Fly   207 TDNVICTSTPGGKSTCAGDSGGPLVLHDRSK--LVGVTSFVAASGCTSGLPDGFTRVTSYLDWI 268
            ||.:||.. ..|.|:|.||||||||....:.  |:|:.|: ....|....|..:|||:.:..||
Mouse   196 TDAMICAG-GSGASSCQGDSGGPLVCQKGNTWVLIGIVSW-GTKNCNIQAPAMYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 78/236 (33%)
Tryp_SPc 43..271 CDD:238113 79/237 (33%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 78/236 (33%)
Tryp_SPc 34..260 CDD:238113 79/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.