DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and CG42694

DIOPT Version :10

Sequence 1:NP_608882.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:218 Identity:52/218 - (23%)
Similarity:73/218 - (33%) Gaps:76/218 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 KRSLTGKR-----LSSRSMDALAQQEKER-----------AAAKDAG------KDAN-------- 391
            |.:.|||:     |:|...| |.|.||.|           |..::||      :|.|        
  Fly    19 KETETGKQERRPYLASECRD-LGQCEKWRLEIIREISKKVAQIQNAGLGEFRIRDLNDEINKLLR 82

  Fly   392 -KRHTMSHPPDHIPDLDSPTRGSRSPIKKDKKERKPAG--------------GVAVL-----PVA 436
             |||.    .:.|.||..|......|...|.:.|:..|              ||..|     |..
  Fly    83 EKRHW----ENQISDLGGPHYRRYGPRMFDAEGREVPGNRGYKYFGAAKDLPGVRELFEQEPPPP 143

  Fly   437 GKKDKPEQVSQKDEGLNG----NNG-------QAE--ALNSSAEEATSPSGKRKGF--------L 480
            .||.:.|.:...|....|    ::|       :||  |:..:.||..|..|..|..        :
  Fly   144 PKKTRAELMKDIDADYYGYRDDDDGILLPLEEKAEKLAIQRAVEEWNSAKGGSKTAEKDDDEPDI 208

  Fly   481 FSSGRKSPKDKKDAGKEQPAKLM 503
            :.|.....:|.:...||.|..|:
  Fly   209 YGSDAYITRDPEQQTKEDPMGLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_608882.1 Tryp_SPc 42..268 CDD:214473
CG42694NP_001188994.1 Tryp_SPc 46..253 CDD:473915 41/190 (22%)
Tryp_SPc 319..502 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.