DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and LOC101733231

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_004913565.1 Gene:LOC101733231 / 101733231 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:279 Identity:88/279 - (31%)
Similarity:120/279 - (43%) Gaps:51/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IACAAAQPEKVKPVPLKDAVLGSGSGSIE------GRITNGYPAYEGKVPYIVGLGFSSDSGGW- 69
            ::|.|          |...|.|.|...|.      .||.||..|..|..|:.|.|   .||..| 
 Frog     7 VSCLA----------LATTVYGCGQPQIAPVVTGYARIVNGEEAVPGSWPWQVSL---QDSTSWH 58

  Fly    70 WCGGSIIGHTWVITAAHC--------THGAHSVTIYYGALWRLQAQYTHTVGSGHFRQHSDYNTN 126
            :||||:|.:.||:|||||        ..|.|........:..|......|        |..:|:|
 Frog    59 FCGGSLINNEWVVTAAHCGVSTRDKVVLGEHDRGSNVEKIQSLAVAKVFT--------HPQWNSN 115

  Fly   127 NLNNDISLIN--TPHVDFWHLINKVELPD--GNERHDSFAGWWALASGWGRP-CDSCGVSDYLNC 186
            .:|||||||.  ||.|     :.....|.  .|...|...|...:.||||:. .::....:.|..
 Frog   116 TINNDISLIKLATPAV-----LGATVAPVCLANTGDDYEGGRICVTSGWGKTRYNAFTTPNQLQQ 175

  Fly   187 VDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGGPLV--LHDRSKLVGVTSFVAASG 249
            ....::|.|:|.|.:|.: ||..:||... .|.|:|.||||||||  .:|...|||:.|: .:|.
 Frog   176 TALPLLTNDQCKSYWGNN-ITGTMICAGA-AGSSSCMGDSGGPLVCQANDAWTLVGIVSW-GSSM 237

  Fly   250 CTSGLPDGFTRVTSYLDWI 268
            |::..|..:.||.....|:
 Frog   238 CSTSTPAVYARVAVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 80/241 (33%)
Tryp_SPc 43..271 CDD:238113 80/242 (33%)
LOC101733231XP_004913565.1 Tryp_SPc 33..256 CDD:214473 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.