DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bii and zgc:165423

DIOPT Version :9

Sequence 1:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:304 Identity:82/304 - (26%)
Similarity:125/304 - (41%) Gaps:71/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTVLAVAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPYIVGLGFSSDSGGW 69
            :|:|:....|   ||.:..|        ..|...:..:|..|..|..|..|:...|   .:||..
Zfish    11 VTLLSTGCDC---QPTQSPP--------ACGKAPLNTKIVGGTNASAGSWPWQASL---HESGSH 61

  Fly    70 WCGGSIIGHTWVITAAHC---THGAHSVTIYYGALWRLQAQYTHTVGSGHFRQHSD--------- 122
            :||||:|...|:::||||   .......|:|.|                  ||..|         
Zfish    62 FCGGSLISDQWILSAAHCFPSNPNPSDYTVYLG------------------RQSQDLPNPNEVSK 108

  Fly   123 ----------YNTNNLNNDISLIN-TPHVDFWHLINKVEL-PDGNERHDS---FAGWWALASGWG 172
                      |..:..:||::|:: :..|.|.:.|..|.| .||:..::.   ..||..:.||..
Zfish   109 SVSQVIVHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCLAADGSTFYNDTMWITGWGTIESGVS 173

  Fly   173 RPCDSCGVSDYLNCVDSQIITRDECSSVY-GTDVITDNVICTS-TPGGKSTCAGDSGGPLVLHDR 235
            .|.     ...|..|:..|:..:.|:.:| |...||:|::|.. ..|||.:|.||||||:|:...
Zfish   174 LPS-----PQILQEVNVPIVGNNLCNCLYGGGSSITNNMMCAGLMQGGKDSCQGDSGGPMVIKSF 233

  Fly   236 SKLV--GVTSFVAASGCTS-GLPDGFTRVTSYLDWIRDHTGISY 276
            :..|  ||.||  ..||.. ..|..:.||:.|.:||..:...|:
Zfish   234 NTWVQAGVVSF--GKGCADPNYPGVYARVSQYQNWISQYVRASF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 72/257 (28%)
Tryp_SPc 43..271 CDD:238113 74/259 (29%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 72/257 (28%)
Tryp_SPc 38..269 CDD:238113 74/258 (29%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.