DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG34409

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:266 Identity:63/266 - (23%)
Similarity:106/266 - (39%) Gaps:58/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEGRITNGYAAPEGKAPYTVGLGFSG------GWWCGGSIIAHDWVLTAEHCIGDAASVIVYF-- 89
            :|.|:..|..|..|:.|:...:.:..      .:.|.||:|:.:.::||.||:.:..|.:...  
  Fly   246 VESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHV 310

  Fly    90 ------GAT-WRTNAQFTHTVGNGNFIKHSNADIALIRIPHVDFWHMVNKVELP---SYNDRY-- 142
                  ||| :.......|.  |.:..|::| ||||:||      :..|....|   .:|...  
  Fly   311 RLGSQDGATPFAIEQVIVHP--NYDQPKYAN-DIALLRI------NSTNGTFTPICLPFNGPITL 366

  Fly   143 -NNYNEWWAVACGW--GGTYDGSPLPD-----WLQCVDLQIVHNEECGWTYGSVGDNV------- 192
             |.......||.||  |.|.:.|.:..     .::.:.|.||:...|...|.|:.:|.       
  Fly   367 GNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVIT 431

  Fly   193 ---ICTRTVDGKSICGGDSGGPLVTHDGSK----------LVGVSNFVSSNGCQSGAPAGFQRVT 244
               :|.:.:....:|.||||||.: .||:.          ::|:..|..:....:..|..:..|:
  Fly   432 PNHLCAQGMPMNDVCRGDSGGPFM-DDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVS 495

  Fly   245 YHLDWI 250
            ...|||
  Fly   496 SFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 60/261 (23%)
Tryp_SPc 37..253 CDD:238113 61/262 (23%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 60/261 (23%)
Tryp_SPc 252..501 CDD:238113 59/258 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.