DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and PROC

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:246 Identity:63/246 - (25%)
Similarity:108/246 - (43%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAH-DWVLTAEHCIGDAASVIVYFG----- 90
            :::.|:.:|.....|.:|:.|.|..|......|:::.| .|||||.||:.::..::|..|     
Human   322 QVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLR 386

  Fly    91 --ATWRTNAQFTHTVGNGNFIKH-SNADIALIRIPH-VDFWHMVNKVELPSYN--DRYNNYNEWW 149
              ..|..:........:.|:.|. ::.||||:.:.. ......:..:.||...  :|..|.....
Human   387 RWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQE 451

  Fly   150 AVACGWGGTYDGSPLPD-------WLQCVDLQIVHNEECGWTYGS-VGDNVICTRTV-DGKSICG 205
            .:..|||  |..|...:       .|..:.:.:|.:.||.....: |.:|::|...: |.:..|.
Human   452 TLVTGWG--YHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACE 514

  Fly   206 GDSGGPLVT--HDGSKLVGVSNFVSSNGCQSGAPAG-FQRVTYHLDWIRDH 253
            ||||||:|.  |....|||:.::  ..||......| :.:|:.:||||..|
Human   515 GDSGGPMVASFHGTWFLVGLVSW--GEGCGLLHNYGVYTKVSRYLDWIHGH 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 60/237 (25%)
Tryp_SPc 37..253 CDD:238113 61/239 (26%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 61/238 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.