DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Tpsab1

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:277 Identity:85/277 - (30%)
Similarity:119/277 - (42%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWW---CGGSI 66
            |.:|.|.:.|:       .|...|........|..|..|...|.|:.|.|..:..:|   ||||:
  Rat    41 LLLLTLPLLSS-------LVHAAPSLAMPREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSL 98

  Fly    67 IAHDWVLTAEHCIG-----------DAASVIVYFGATWRTNAQFTHTVGNGNF-IKHSNADIALI 119
            |...|||||.||:|           ......:|:.....|.:|.   :.:.:| |....|||||:
  Rat    99 IHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQI---ISHPDFYIAQDGADIALL 160

  Fly   120 RIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYD--GSPLPDWLQCVDLQIVHNEEC 181
            ::.: |:....|:.|.||..::.:.:....|..  |||...:  ..|.|..|:.|.:.||.|..|
  Rat   161 KLTNPVNITSNVHTVSLPPASETFPSGTLCWVT--GWGNINNDVSLPPPFPLEEVQVPIVENRLC 223

  Fly   182 GWTYG---SVGDNV-------ICTRTVDGKSICGGDSGGPLV--THDGSKLVGVSNFVSSNGC-Q 233
            ...|.   :.||||       :|... :|...|.||||||||  ..|.....||.::  ..|| |
  Rat   224 DLKYHKGLNTGDNVHIVRDDMLCAGN-EGHDSCQGDSGGPLVCKVEDTWLQAGVVSW--GEGCAQ 285

  Fly   234 SGAPAGFQRVTYHLDWI 250
            ...|..:.||||:||||
  Rat   286 PNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 77/244 (32%)
Tryp_SPc 37..253 CDD:238113 79/245 (32%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 77/243 (32%)
Tryp_SPc 66..302 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.