DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and prss27

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:269 Identity:77/269 - (28%)
Similarity:119/269 - (44%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PKATK-----IEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI---GDAAS 84
            |.||.     :..||..|.:|.||:.|:.|....:||.:|||::|:..:|::|.||.   ..|:|
 Frog    20 PGATDCGIPLVSSRIMGGQSAQEGQWPWQVSFRNNGGHFCGGTLISKQYVISAAHCFPSSSSASS 84

  Fly    85 VIVYFGATW-------------RTNAQFTHTVGNGNFIKHSNADIALIRIPH-VDFWHMVNKVEL 135
            |....||..             ::...:...|..|:     :.||:|:::.. |.|.:.:..|.|
 Frog    85 VTAVLGAYMIDQPDGNQVAIPVQSATNYPSYVNEGD-----SGDISLVQLASPVTFTNYILPVCL 144

  Fly   136 PSYNDRYNNYNEWWAVACGWGGTYDGSPL--PDWLQCVDLQIVHNEECGW------TYG----SV 188
            |:....:....:.|..  |||.......|  |..||.|.:.::...||..      :||    ||
 Frog   145 PADTVTFPTGLQCWVT--GWGNIASDVSLVSPMTLQEVAVPLIDANECNALYQTPNSYGTSSISV 207

  Fly   189 GDNVICTRTVD-GKSICGGDSGGPLVTHDGSK--LVGVSNFVSSNGC-QSGAPAGFQRVTYHLDW 249
            ..::||...:: ||..|.||||||||.....:  |.||.:|  ..|| |:..|..:..:..:.||
 Frog   208 HSDMICAGFINGGKDSCQGDSGGPLVCSSSGQWFLAGVVSF--GEGCGQAYRPGVYTLMPSYTDW 270

  Fly   250 IRDHTGISY 258
            |     :||
 Frog   271 I-----VSY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 70/246 (28%)
Tryp_SPc 37..253 CDD:238113 71/248 (29%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 69/245 (28%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.