DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and ctrl

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:233 Identity:74/233 - (31%)
Similarity:101/233 - (43%) Gaps:27/233 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYAAPEGKAPYTVGLGFSGGW-WCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNA-- 97
            ||.||..|..|..|:.|.|..|.|: :||||:|...||:||.||...|....|..|...|.::  
Zfish    31 RIVNGENAVSGSWPWQVSLQQSNGFHFCGGSLINQYWVVTAAHCRVQAGYHYVILGEHDRGSSAE 95

  Fly    98 ---------QFTHTVGNG-NFIKHSNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAV 151
                     ..||...|. ||    |.||.|:::.. ......::.|.|.:.:....:...  .|
Zfish    96 SVQVKSIAKAITHPYYNSQNF----NNDITLLKLSSPAQLTSRISPVCLAASSTSIPSGTR--CV 154

  Fly   152 ACGWGGTYDGSPLPDWLQCVDLQIVHNEECG--WTYGSVGDNVICTRTVDGKSICGGDSGGPLVT 214
            ..|||.|...|. |..||...|.::...:|.  |....:.|.:||. ...|.|.|.||||||||.
Zfish   155 TTGWGKTGSTSS-PRILQQTALPLLSPAQCKQYWGQNRITDAMICA-GASGVSSCQGDSGGPLVC 217

  Fly   215 HDGSK--LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250
            .....  .||:.::.:|: |....||.:.||:|...||
Zfish   218 ESSGAWYQVGIVSWGTSD-CNVRTPAVYARVSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 72/231 (31%)
Tryp_SPc 37..253 CDD:238113 73/232 (31%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 72/231 (31%)
Tryp_SPc 32..257 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.