DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Jon99Fii

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:269 Identity:169/269 - (62%)
Similarity:202/269 - (75%) Gaps:13/269 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILALAVASASAF--DEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFS--GGWW 61
            ||:|: .||||||:|:|.  .|:..|....|..||:|||||||.|.|||.||.|||.||  |.||
  Fly     1 MKLFV-FLALAVAAATAIPTPEQKLVPTPVKDVKIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW 64

  Fly    62 CGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHS-------NADIALI 119
            ||||||.:.|||||.||...|:.|.:.:||:.|...|:||.||:|||::|.       :.||:||
  Fly    65 CGGSIIGNTWVLTAAHCTNGASGVTINYGASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLI 129

  Fly   120 RIPHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWT 184
            |.|||||||:|||||||||||||.:|..|||||.||||||||||||||||.||:||:...:|..:
  Fly   130 RTPHVDFWHLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRS 194

  Fly   185 YGSVGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDW 249
            : |:.||:||..|..|||.||||||||||||:|::||||::||||.||||||||.|.|||.:|||
  Fly   195 W-SLHDNMICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDW 258

  Fly   250 IRDHTGISY 258
            |||:|||||
  Fly   259 IRDNTGISY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 143/222 (64%)
Tryp_SPc 37..253 CDD:238113 145/224 (65%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 143/222 (64%)
Tryp_SPc 38..262 CDD:238113 145/224 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470748
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.