DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG11841

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:317 Identity:74/317 - (23%)
Similarity:112/317 - (35%) Gaps:106/317 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AILALAVASASAFDEKV----FVKDLP----KATKIEGR---ITNGYAAPEGKAPYTVGLGFSG- 58
            |.||........|:|:|    |..|.|    ......|.   |.:|..|...:.|:...||... 
  Fly    30 AQLACTKFKQIVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKT 94

  Fly    59 ----GWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSNADIALI 119
                .|:|||::|::..||||.||.                            |.:|  .::.::
  Fly    95 NNEIKWFCGGTLISNRLVLTAAHCF----------------------------FSEH--GEVNVV 129

  Fly   120 RIPHV------------DFWHMVNKV----ELPS-YND----------RYNNY------------ 145
            |:..:            ||..:..|.    |.|. |||          ::|.|            
  Fly   130 RLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGE 194

  Fly   146 -NEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGSVGDN-----------VICTRTV 198
             :|.: :|.|||...........|..|.|| .:.:.|   ..||..|           .:|..:.
  Fly   195 QHESF-IAIGWGQKKFAQKESKKLLKVQLQ-GYKDRC---VSSVDANDELPNGYEPKSQLCIGSR 254

  Fly   199 DGKSICGGDSGGPLVTH--DGSKLVGVSNFVSSN-GCQS-GAPAGFQRVTYHLDWIR 251
            |.|..|.||||||::.:  |.:.:..|....|:. .|.: ..|:.:.||.|.|:||:
  Fly   255 DNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 62/276 (22%)
Tryp_SPc 37..253 CDD:238113 64/275 (23%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 63/273 (23%)
Tryp_SPc 72..310 CDD:214473 62/272 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.