DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG4815

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:215 Identity:49/215 - (22%)
Similarity:88/215 - (40%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSIIAHDWVLTAEHC-----------IGDAASVIVYFGATWRTN----AQFTHTVGNGNFIKH 111
            |..:::....:|||.||           ||..::...:.|..:..|    .|.........||  
  Fly    61 CSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFI-- 123

  Fly   112 SNADIAL------IRIPHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGW---GGTYDGSPLPDW 167
              ||:|:      :|..::.:..:...|..|  .|:        .:|.||   ||.:|.|....:
  Fly   124 --ADVAVAKTKYPLRSKYIGYAQLCRSVLHP--RDK--------LIAAGWGFEGGVWDESRKKTF 176

  Fly   168 LQCVDLQIVHNEECGWTYG-SVGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNG 231
             :.:.:.||...:|..... .:..|:||....:.|::|.|||||||:.  |.::.|::.:....|
  Fly   177 -RSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGGPLLL--GRQVCGINTWTFKCG 238

  Fly   232 CQSGAPAGFQRVTYHLDWIR 251
             .:..|..:..|.|:..:|:
  Fly   239 -NNEKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 48/212 (23%)
Tryp_SPc 37..253 CDD:238113 49/215 (23%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 49/215 (23%)
Trypsin 49..256 CDD:278516 48/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.