DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG10232

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:270 Identity:61/270 - (22%)
Similarity:98/270 - (36%) Gaps:75/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYAAPEGKAPYTVGLGFSGGWW------CGGSIIAHDWVLTAEHCI--------------- 79
            |:..|.||...:.|:...|.:.....      |.||:|...:||||.||:               
  Fly   256 RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNTDLVLRRV 320

  Fly    80 ----------------GDAASVIVYFGATW-RTNAQFTHTVGNGNFIKHSNADIALIRI-PHVDF 126
                            |:.|:..|..|..: ..:.|:.:|       ....:||||:|: ..|.:
  Fly   321 RLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNT-------SRFESDIALVRLQTPVRY 378

  Fly   127 WHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYD---------GSPLPDWLQCVD-LQIVHNEEC 181
            .|.:..:.:|  .|....:|....:| |||.|.:         .:...:...|.| :....||  
  Fly   379 THEILPICVP--KDPIPLHNHPLQIA-GWGYTKNREYSQVLLHNTVYENRYYCQDKISFFRNE-- 438

  Fly   182 GWTYGSVGDNVICTRTVDGKSICGGDSGGPL---VTHDGSKLVGVSNFVS--SNGCQSGAPAGFQ 241
                     :.||...:.|:..|.|||||||   :.:|...:|.::..||  |..|....|..:.
  Fly   439 ---------SQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSENCGDRKPGVYT 494

  Fly   242 RVTYHLDWIR 251
            :......||:
  Fly   495 KTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 59/267 (22%)
Tryp_SPc 37..253 CDD:238113 60/269 (22%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 60/266 (23%)
Tryp_SPc 260..503 CDD:214473 58/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.