DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and SPE

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:237 Identity:64/237 - (27%)
Similarity:97/237 - (40%) Gaps:54/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSIIAHDWVLTAEHCIG----DAASVIVY---FGATW--RTNAQFTHTVGNGNFI---KH--- 111
            |||:::...:||||.||:.    |.:..:::   .| .|  ||:...| |..||..|   ||   
  Fly   166 CGGALLNSRYVLTAGHCLASRELDKSGAVLHSVRLG-EWDTRTDPDCT-TQMNGQRICAPKHIDI 228

  Fly   112 -----------------SNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGT 158
                             ...||||:|:.. |.:...|..:.||:.....||:.::.....|||.|
  Fly   229 EVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLT 293

  Fly   159 YDGSPLPDWLQCVDLQIVHN----EECGWTYGS----VGDNVICTRTVDGKSICGGDSGGPLVT- 214
            .:..|     ..:.|:|..|    ..|...|.|    :.|:.:|.....|...|||||||||:. 
  Fly   294 ENMQP-----SAIKLKITVNVWNLTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVP 353

  Fly   215 -----HDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251
                 .|...:.||:::.:......|.|..:.|....:|||:
  Fly   354 ISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 62/234 (26%)
Tryp_SPc 37..253 CDD:238113 64/237 (27%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 64/237 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.