DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG16710

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:91/239 - (38%) Gaps:67/239 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTV-GNGNFIKHSNA----------- 114
            |.||:|.:.:||||.||:.       ..|...|......|.: .|.:.:.|.|.           
  Fly   141 CAGSLITNRYVLTAAHCLR-------ITGLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEI 198

  Fly   115 --------------------DIALIRIPH-VDFWHMVN----KVELPSYNDRYNNYNEWWAVACG 154
                                ||||:|:.. |.:...:.    :::....|..::|:.   ....|
  Fly   199 DVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHK---LQIAG 260

  Fly   155 WGGTYDGSPLPDWLQCVDLQIVHN----EECGWTYGSVG---DNVICTRTVDGKSICGGDSGGPL 212
            ||.::     ......|.||...|    :||..:..|:|   :..||...:.|...|.|||||||
  Fly   261 WGLSH-----KQGYSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPL 320

  Fly   213 --VTHDGSK----LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250
              :...|.:    |.|::::..|. |..| ||.:.:.:..::||
  Fly   321 MAIMERGDEEFVYLAGITSYGYSQ-CGYG-PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 54/237 (23%)
Tryp_SPc 37..253 CDD:238113 56/239 (23%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 54/237 (23%)
Tryp_SPc 106..362 CDD:238113 54/237 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.