DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG5255

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:281 Identity:86/281 - (30%)
Similarity:126/281 - (44%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTV---GLGFSGGWWCGG 64
            :.|.:|.|.:.::||..:.::.   |:.||  .||..|..|..|.|||.:   |:| ||...|||
  Fly     1 MLLILLPLVLFTSSAASQILYP---PQYTK--NRIVGGEEAAAGLAPYQISLQGIG-SGAHSCGG 59

  Fly    65 SIIAHDWVLTAEHCI-GDAASVIVYFGATWRTNAQFTHTVGN-----GNFIKHSN-------ADI 116
            :||...|::||.||. |..|:.....     |..|..|..|:     ...::|||       .||
  Fly    60 AIIDERWIITAAHCTRGRQATAFRVL-----TGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDI 119

  Fly   117 ALIRI-PHVDFWHMVNKVEL------PSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQ 174
            ||:.: ..:.|.:....|||      |...          .:..|||....|..:|..||.:::.
  Fly   120 ALLHLNESIVFDNATQPVELDHEALVPGSR----------LLLTGWGTLSLGGDVPARLQSLEVN 174

  Fly   175 IVHNEECGWTYGS---VGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGA 236
            .|..|:|...:.:   |....:||....|:..|.|||||||| |:| |||.:.|:  ...|..|.
  Fly   175 YVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV-HNG-KLVALVNW--GLPCAKGY 235

  Fly   237 PAGFQRVTYHLDWIRDHTGIS 257
            |.....::|:.|:||.|..:|
  Fly   236 PDAHASISYYHDFIRTHLSLS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 74/239 (31%)
Tryp_SPc 37..253 CDD:238113 75/241 (31%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/239 (31%)
Tryp_SPc 30..252 CDD:238113 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436785
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.