DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG17475

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:288 Identity:87/288 - (30%)
Similarity:118/288 - (40%) Gaps:63/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILAL-------AVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGL-GFS 57
            :::.:.:||.       ||..|...::::......:....:.|:.||.....|:|.|.:.| |..
  Fly     7 VQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMY 71

  Fly    58 GGWWCGGSIIAHDWVLTAEHCI-------------------GDAASVIVYFGATWRTNAQFTHTV 103
            ||..|||.||....||||.||:                   .||    |||     ....:.|. 
  Fly    72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDA----VYF-----VEEHWIHC- 126

  Fly   104 GNGNFIKHSNADIALIRI-PHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDW 167
             |.|...:.| ||||||: ..:.|.......|||:....    |....:..|||.|......||.
  Fly   127 -NYNSPDYHN-DIALIRLNDTIKFNEYTQPAELPTAPVA----NGTQLLLTGWGSTELWGDTPDI 185

  Fly   168 LQCVDL---------QIVHNEECGWTYGSVGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGV 223
            ||...|         :|::|:.      |.|...|||.|..|:..|.||||||| ||:| .|.|:
  Fly   186 LQKAYLTHVVYSTCQEIMNNDP------SNGPCHICTLTTGGQGACHGDSGGPL-THNG-VLYGL 242

  Fly   224 SNFVSSNGCQSGAPAGFQRVTYHLDWIR 251
            .|:  ...|..|.|.....|.|:|:|||
  Fly   243 VNW--GYPCALGVPDSHANVYYYLEWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 79/243 (33%)
Tryp_SPc 37..253 CDD:238113 81/245 (33%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 79/243 (33%)
Tryp_SPc 50..269 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.