DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG17477

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:236 Identity:79/236 - (33%)
Similarity:107/236 - (45%) Gaps:27/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEGRITNGYAAPEGKAPYTVGL-GFSGGWWCGGSIIAHDWVLTAEHCIGD--------AASVIVY 88
            :|..|..|..|.||.|||.|.| ...|...|||:||:..|::||.||:..        |...|.|
  Fly    23 LEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPTSRLQVATGTIRY 87

  Fly    89 F--GATWRTNAQFTHTVGNGNFIKHSNADIALIRI-PHVDFWHMVNKVELPSYNDRYNNYNEWWA 150
            .  ||.:..:|.:.|.  |.:..|:.| ||.|:.: ..:.|..:...||||: :......:|  .
  Fly    88 AEPGAVYYPDAIYLHC--NYDSPKYQN-DIGLLHLNESITFNALTQAVELPT-SPFPRGASE--L 146

  Fly   151 VACGWGGTYDGSPLPDWLQCVDLQIVHNEEC-----GWTYGSVGDNVICTRTVDGKSICGGDSGG 210
            |..|||.......||..||.|..|.:::..|     .:....:|...||.........|.|||||
  Fly   147 VFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGG 211

  Fly   211 PLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251
            ||| |.|: |||:.||...  |..|.|..|..:.|:.||:|
  Fly   212 PLV-HQGT-LVGILNFFVP--CAQGVPDIFMNIMYYRDWMR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 76/230 (33%)
Tryp_SPc 37..253 CDD:238113 78/232 (34%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 78/232 (34%)
Tryp_SPc 27..246 CDD:214473 75/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.