DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG31326

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:258 Identity:66/258 - (25%)
Similarity:102/258 - (39%) Gaps:59/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYAAPEGKAPYTVGLGF----SGG--WWCGGSIIAHDWVLTAEHCIG------DAASVIVYF 89
            |..|.:...|:.|:.|.: |    |.|  :.|||::|:...||:|.||..      .|:.:.|..
  Fly   274 IFQGKSLQRGQLPWLVAI-FERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRDLPASRLAVSL 337

  Fly    90 GATWRTNAQFTHTVG------------NGNFIKHSNADIALIR----IPHVDF------WHMVNK 132
            |    .|....|:.|            |..|.:.:.||:||:|    :.:.|:      |...|:
  Fly   338 G----RNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYIVPICLWSTSNR 398

  Fly   133 VELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECG--WTYGSVGDNVICT 195
            ::||.....|         ..|||....|:...:..:..||.||....|.  ..:..|..:.:|.
  Fly   399 MDLPQGLKSY---------VAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVLVQPSSLCA 454

  Fly   196 RTVDGKSICGGDSGGPLVTHDGSKLV-------GVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251
            :.. |...|..|.||||:..:....|       ||.| ...|.|:...|:.|..|..|::|:|
  Fly   455 KKT-GAGPCASDGGGPLMLREQDVWVLRGVISGGVIN-EKENTCELSKPSVFTDVAKHIEWVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 64/255 (25%)
Tryp_SPc 37..253 CDD:238113 66/258 (26%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 65/255 (25%)
Tryp_SPc 277..514 CDD:214473 63/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.