DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG8870

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:239 Identity:57/239 - (23%)
Similarity:87/239 - (36%) Gaps:66/239 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHT-----VGNG--------------N 107
            ||||:|.:.:||||.||:........|...|.|.....|.|     :.||              .
  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181

  Fly   108 FIKHSN--------ADIALIRIPH-VDFWHMVNKVELP------SYNDRYNNYNEWWAVACGWGG 157
            .|.|..        .||||:|:.. |.:...:..:.||      ::..::.        |.||  
  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQ--------ASGW-- 236

  Fly   158 TYDGSPLPDWLQCVDLQIV--------HNEECGWTYGSVGDNVICTRTVDGKSICGGDSGGPL-- 212
                   ||..|.:..:::        |.:.|...|.....:.||...:||.....|||||||  
  Fly   237 -------PDMGQGIASEVLLRSFIAERHPDVCKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLME 294

  Fly   213 -VTHDGSKLVGVSNFVS--SNGC--QSGAPAGFQRVTYHLDWIR 251
             |......|...:..:|  ...|  ::..||.:.:.:|..:||:
  Fly   295 TVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 55/236 (23%)
Tryp_SPc 37..253 CDD:238113 57/239 (24%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 57/239 (24%)
Tryp_SPc 93..337 CDD:214473 55/236 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.