DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG18223

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:284 Identity:69/284 - (24%)
Similarity:117/284 - (41%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLAILALAVASASAFDE--KVFVKDLPKATKIEGRITNGYAAPEGK---APYTVGLG-------F 56
            ||..|.|.:....|.|.  ..||:...|      |:::.|...|..   |.|.|.:.       |
  Fly    15 FLLFLLLLLPILDAGDPIGSHFVRRRAK------RLSSPYFDKEKTLVLAKYVVSIRSRRPHKLF 73

  Fly    57 SGGWWCGGSIIAHDWVLTAEHCIGDAASV-------IVYFGATWR--------TNAQFTHTVGNG 106
            ....:|||.||:..::||:.||..|...:       :|..|.|.|        .|.:........
  Fly    74 GDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPD 138

  Fly   107 NFIKHSNADIALI----RIPHVDFWHMVNKVELPSYNDRYN-NYNEWWAVACGWGGTYDGSPLPD 166
            .|...:..:|||:    ::|..:  .:|..:.||:.:.... ||     ...|||..:.|.||..
  Fly   139 KFTVFNTNNIALMMLAKKLPLDN--PLVGVINLPTADPEPGLNY-----TVLGWGRIFKGGPLAS 196

  Fly   167 WLQCVDLQIVHNEECGWTYGSVGDNVIC----TRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFV 227
            .:..:|::::..:.|........:.::|    ..|:| ::.|.||:|.||:.::  .:.||.:: 
  Fly   197 DILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMD-ENPCAGDTGSPLIFNE--TVFGVVSY- 257

  Fly   228 SSNGCQSGA-PAGFQRVTYHLDWI 250
             ..||.|.. |:.:..|..|:|||
  Fly   258 -RVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 58/248 (23%)
Tryp_SPc 37..253 CDD:238113 59/249 (24%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 56/233 (24%)
Tryp_SPc 60..280 CDD:214473 54/231 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.