DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG7542

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:273 Identity:106/273 - (38%)
Similarity:140/273 - (51%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFS-GGW--WCGGSI 66
            |.:..|.|.|.:|         :|..|.:|..||||..|..|:.||..||..| |.|  ||||::
  Fly     4 LLVCVLLVGSCTA---------VPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTL 59

  Fly    67 IAHDWVLTAEHCIGDAASVIVYFGA----TWRTNAQFTHTVGNGNFIKHSN-------ADIALIR 120
            |:|.|::||.||:..|.||.||.||    ......|....|.....|.|||       .||:|||
  Fly    60 ISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIR 124

  Fly   121 IP-HVDFWHMVNKVELP-SYNDRYNNYNEWWAVACGWGGTYDG----SPLPDWLQCVDLQIVHNE 179
            :| .|.|...:....|| ..|.::..|....|.|.|||...|.    ||:   |:.|::.|:.:.
  Fly   125 LPAFVGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPV---LRYVEMPIMPHS 186

  Fly   180 ECG--WTYGSVGDNVICTRTVDGKSICGGDSGGPLVTHDG--SKLVGVSNFVSSNGCQSGAPAGF 240
            .|.  |: |:|.:.:||..|..|||.|.||||||||...|  |.|:|.::|.:|.|||.|.||.|
  Fly   187 LCRMYWS-GAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVF 250

  Fly   241 QRVTYHLDWIRDH 253
            .|::.:||||.:|
  Fly   251 TRISSYLDWILNH 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 95/237 (40%)
Tryp_SPc 37..253 CDD:238113 97/239 (41%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 97/239 (41%)
Tryp_SPc 27..260 CDD:214473 95/236 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470935
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.