DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and ctrb1

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_002944677.2 Gene:ctrb1 / 394984 XenbaseID:XB-GENE-977509 Length:263 Species:Xenopus tropicalis


Alignment Length:259 Identity:87/259 - (33%)
Similarity:119/259 - (45%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VKDLPKATKIEG--------------RITNGYAAPEGKAPYTVGLGFSGGW-WCGGSIIAHDWVL 73
            |..|..||.:.|              ||.||..|..|..|:.|.|..|..| :||||:|.::||:
 Frog     7 VSCLALATTVYGCGQPQIAPVVTGYARIVNGEEAVPGSWPWQVSLQDSTSWHFCGGSLINNEWVV 71

  Fly    74 TAEHCIGDAASVIVYFGATWR-TNAQ----------FTHTVGNGNFIKHSNADIALIRI--PHVD 125
            ||.|| |.:....|..|...| :|.:          |||...|.|.|   |.||:||::  |.| 
 Frog    72 TAAHC-GVSTRDKVVLGEHDRGSNVEKIQSLAVAKVFTHPQWNSNTI---NNDISLIKLATPAV- 131

  Fly   126 FWHMVNKVELPSYNDRYNNYNEWWAVACGWGGT-YDGSPLPDWLQCVDLQIVHNEECGWTYG-SV 188
            ....|..|.|.:..:.|....  ..|..|||.| |:....|:.||...|.::.|::|...:| ::
 Frog   132 IGATVAPVCLANIGEDYEGGR--ICVTSGWGKTRYNAFTTPNQLQQTALPLLTNDQCKSYWGNNI 194

  Fly   189 GDNVICTRTVDGKSICGGDSGGPLV--THDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250
            ...:||.... |.|.|.||||||||  .:|...|||:.::.||. |.:..||.:.||.....|:
 Frog   195 TGTMICAGAA-GSSSCMGDSGGPLVCQANDAWTLVGIVSWGSSM-CSTSTPAVYARVAVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 81/231 (35%)
Tryp_SPc 37..253 CDD:238113 81/232 (35%)
ctrb1XP_002944677.2 Tryp_SPc 33..256 CDD:214473 81/231 (35%)
Tryp_SPc 34..259 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.