DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG8329

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:267 Identity:124/267 - (46%)
Similarity:163/267 - (61%) Gaps:26/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAILALAVASASAFDEKVFV-------KDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWC 62
            |.:|.|.||:..|...:...       ||:         |.|||.|.||||||.|||..:.|...
  Fly     5 LVLLLLFVATVCAHRNRNRTAHHGGGPKDI---------IVNGYPAYEGKAPYAVGLRMNNGAVG 60

  Fly    63 GGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKH------SNADIALIRI 121
            |||:|.::|||||.||: ...||.:::|:....|.|..|||...||.:|      :..||.|||.
  Fly    61 GGSVIGNNWVLTAAHCL-TTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLIRT 124

  Fly   122 PHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYG 186
            |:|.|.:::|||.||.::.:...:..||.|||||||..:|. |.|||||:|:|::.|.||..:||
  Fly   125 PYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGG-LADWLQCMDVQVISNGECARSYG 188

  Fly   187 SVGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251
            ||....:|||..||||:|||||||.|||||....|||..| :|.||:|| |:|:.||:.||||||
  Fly   189 SVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITF-ASIGCKSG-PSGYTRVSDHLDWIR 251

  Fly   252 DHTGISY 258
            :.:||:|
  Fly   252 EKSGIAY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 110/219 (50%)
Tryp_SPc 37..253 CDD:238113 113/221 (51%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 113/221 (51%)
Tryp_SPc 35..250 CDD:214473 110/218 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.