powered by:
Protein Alignment Jon25Biii and CG33460
DIOPT Version :9
Sequence 1: | NP_608881.1 |
Gene: | Jon25Biii / 33706 |
FlyBaseID: | FBgn0031653 |
Length: | 258 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033949.1 |
Gene: | CG33460 / 3885588 |
FlyBaseID: | FBgn0053460 |
Length: | 275 |
Species: | Drosophila melanogaster |
Alignment Length: | 31 |
Identity: | 12/31 - (38%) |
Similarity: | 18/31 - (58%) |
Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 PYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI 79
|:|..|...|..:|.|::|...::|||..||
Fly 44 PWTALLHTDGSIFCAGTLITDVFILTAASCI 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45435806 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24260 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.