DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG33460

DIOPT Version :10

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:31 Identity:12/31 - (38%)
Similarity:18/31 - (58%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PYTVGLGFSGGWWCGGSIIAHDWVLTAEHCI 79
            |:|..|...|..:|.|::|...::|||..||
  Fly    44 PWTALLHTDGSIFCAGTLITDVFILTAASCI 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 37..253 CDD:238113 12/31 (39%)
CG33460NP_001033949.1 Tryp_SPc 44..249 CDD:473915 12/31 (39%)

Return to query results.
Submit another query.