DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG10469

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:258 Identity:82/258 - (31%)
Similarity:116/258 - (44%) Gaps:54/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYAAPEGKAPYTVGL--GFSGGW----WCGGSIIAHDWVLTAEHCIGDAAS----VIVYFG 90
            ||.||.||...:.||.|||  .|.|..    .|||:|:::.|::||.||:.|..|    |:::.|
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87

  Fly    91 ATWR-------TNAQFT--------HTVGNGNFIKHSNADIALIRIP-HVDFWHMVNKVELPSYN 139
            ....       .|..:|        .||.|         |||||::| .:.|...:...:|||..
  Fly    88 KVKSFDDKEIVVNRSYTIVHKKFDRKTVTN---------DIALIKLPKKLTFNKYIQPAKLPSAK 143

  Fly   140 DRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEEC---------GWTYGSVGDNVICT 195
            ..|....   |:..|||.|....| ...||.:...|:.|:||         |.:...|.:..|| 
  Fly   144 KTYTGRK---AIISGWGLTTKQLP-SQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFIC- 203

  Fly   196 RTVDGKS--ICGGDSGGPLVTHDGSK-LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDHTG 255
              :|.|.  .|.||||||:|..|||: |||:.:......|:...|....||:.:|.||:.::|
  Fly   204 --IDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 79/251 (31%)
Tryp_SPc 37..253 CDD:238113 80/253 (32%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 79/251 (31%)
Tryp_SPc 24..260 CDD:238113 79/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471019
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.