DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG10472

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:281 Identity:106/281 - (37%)
Similarity:143/281 - (50%) Gaps:35/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASAFDEKVFVKDL------PKA---TKIEGRITNGYAAPEGKAPYTVGLGF---SGG 59
            :|...:..|.|.|.. .||:|      ||.   |...||||.|..|...:.||.|||..   .|.
  Fly     9 LLLATILGAQAVDWN-SVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGGA 72

  Fly    60 WWCGGSIIAHDWVLTAEHCIGD-AASVIVYFGATWRTNAQ-------FTHTVGNGNFIKHSN--- 113
            .||||:||:..|::||.||... ...|.||.||..||||:       |..|   .|.|.|.:   
  Fly    73 AWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVET---KNVIVHEDWIA 134

  Fly   114 ----ADIALIRIP-HVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSP-LPDWLQCVD 172
                .||:||::| .::|...:...:||..:|.|:.|....|:|.|||...|.:. ..|.||...
  Fly   135 ETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYAT 199

  Fly   173 LQIVHNEECG-WTYGSVGDNVICTRTVDGKSICGGDSGGPLVTHDGSK-LVGVSNFVSSNGCQSG 235
            :.|::|..|. |.:|.|..:.||.:|..|.|.|.||||||||..|||. |:|.::|..:.||:.|
  Fly   200 VPIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVG 264

  Fly   236 APAGFQRVTYHLDWIRDHTGI 256
            .|..|.|:||:||||.:.:|:
  Fly   265 WPGVFTRITYYLDWIEEKSGV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 92/235 (39%)
Tryp_SPc 37..253 CDD:238113 93/237 (39%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 92/235 (39%)
Tryp_SPc 47..282 CDD:238113 93/237 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470913
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.