DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and yip7

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:273 Identity:128/273 - (46%)
Similarity:167/273 - (61%) Gaps:20/273 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILALAVASASA----FDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFS---G 58
            ||||: :|.||:|||||    ....|..:|......|.||||||..|..|:.||.|||.||   |
  Fly     1 MKVFV-VLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAG 64

  Fly    59 GWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSN-------ADI 116
            .||||||||.::|||||.||...||||.:|:|||.||:.:||..|.:..|.:|.:       .||
  Fly    65 SWWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDI 129

  Fly   117 ALIRIPHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYD-GSPLPDWLQCVDLQIVHNEE 180
            :||:...|.|...|||:.||:.::.|:.|....|||.|||.|.| .:.:...||.|||.|:.|.:
  Fly   130 SLIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSK 194

  Fly   181 CGWTYGS--VGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRV 243
            |..|:||  |...|:|..|.:..|.|.|||||||.. || .|:|.::|.|::||:|||||.|.|:
  Fly   195 CQETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLAL-DG-VLIGATSFGSADGCESGAPAAFTRI 257

  Fly   244 TYHLDWIRDHTGI 256
            ||:.|||::.:||
  Fly   258 TYYRDWIKETSGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 108/226 (48%)
Tryp_SPc 37..253 CDD:238113 109/228 (48%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 108/226 (48%)
Tryp_SPc 40..267 CDD:238113 109/228 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470866
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.