DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG13527

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:255 Identity:64/255 - (25%)
Similarity:105/255 - (41%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATW---- 93
            |..|..|.|              |....:|||.::::.||:||.||:...:.::  :.|.|    
  Fly    47 IRSRTPNKY--------------FGDNHYCGGGLLSNQWVITAAHCVMGQSKIM--YKARWLLVV 95

  Fly    94 -RTNAQFTHTVGNG------------NFIKHSNADIALIRI--------PHVDFWHMVNKVELPS 137
             .:..:..:|.|..            ||..|:..::||:::        |.:.|.|:..  |.|.
  Fly    96 AGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSNDPRIGFLHLPK--EAPK 158

  Fly   138 YNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGSVGDNVICTR----TV 198
            ...|:        ...|||..|.|.||...:..||:.::.|..|...:...||.::|..    |:
  Fly   159 IGIRH--------TVLGWGRMYFGGPLAVHIYQVDVVLMDNAVCKTYFRHYGDGMMCAGNNNWTI 215

  Fly   199 DGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDHTGISY 258
            |.:. |.||.|.||::  |..:||:..:....|| :..|:.:..|...|.||| ||...:
  Fly   216 DAEP-CSGDIGSPLLS--GKVVVGIVAYPIGCGC-TNIPSVYTDVFSGLRWIR-HTAYDW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 58/242 (24%)
Tryp_SPc 37..253 CDD:238113 60/244 (25%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 62/249 (25%)
Tryp_SPc 43..263 CDD:214473 59/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.