DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and PRSS48

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:255 Identity:71/255 - (27%)
Similarity:104/255 - (40%) Gaps:59/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFT 100
            |:..|..|..|:.|:.|.|.|...:.||||:::...:|||.|||          ..||.|   |:
Human    50 RVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCI----------QPTWTT---FS 101

  Fly   101 HTVGNGNF--------IKH-------------SNADIALIRI-PHVDFWHMVNKVELPSYNDRYN 143
            :||..|:.        :|:             :.||:||::: ..|.|...:..:.|||...:..
Human   102 YTVWLGSITVGDSRKRVKYYVSKIVIHPKYQDTTADVALLKLSSQVTFTSAILPICLPSVTKQLA 166

  Fly   144 NYNEWWAVACGWGGTYDGSPLPDW---LQCVDLQIVHNEECGWTYGSVG------------DNVI 193
            .....|..  |||...:.|. .|:   ||..::.|:..:.|...|..:|            |.:.
Human   167 IPPFCWVT--GWGKVKESSD-RDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKIC 228

  Fly   194 CTRTVDGKSICGGDSGGPLVTH-DGSKLVGVSNFVSSNG--CQSGAPAGFQRVTYHLDWI 250
            ...|.:.|..|.|||||||..| ||   |.:...|.|.|  |....|..:..|.|:..||
Human   229 AGDTQNMKDSCKGDSGGPLSCHIDG---VWIQTGVVSWGLECGKSLPGVYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 69/253 (27%)
Tryp_SPc 37..253 CDD:238113 70/254 (28%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 69/253 (27%)
Tryp_SPc 51..288 CDD:238113 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.