DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and psh

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:296 Identity:80/296 - (27%)
Similarity:121/296 - (40%) Gaps:88/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLG---FSGGWWCGGSIIAHDWV 72
            |||:.....|:   |......::...|..||....|..|:...:|   |...:.||||:||..:|
  Fly   121 AVAACKKIRER---KQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGYITFGTDFRCGGSLIASRFV 182

  Fly    73 LTAEHCIGDAAS--VIVYFGATWRTNAQFTHT-------------VGNGNFIKHSNADIALIRIP 122
            |||.||:...|:  ..|..||....|...::.             |||    |::  |||::.:.
  Fly   183 LTAAHCVNTDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGN----KYN--DIAILELE 241

  Fly   123 --------------HVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWG----GTYDGSPLPDWLQ 169
                          |.|      ..:.|| |.::        ...|||    .|...|.:   |.
  Fly   242 RDVVETDNIRPACLHTD------ATDPPS-NSKF--------FVAGWGVLNVTTRARSKI---LL 288

  Fly   170 CVDLQIVHNEECGWTY----GSVG-------DNVICTRTVDGKSI---CGGDSGGPLV----THD 216
            ...|::|..::|..:|    ||:.       |:::|  .:|.|.|   |.|||||||:    ..|
  Fly   289 RAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLC--AIDQKLIADACKGDSGGPLIHELNVED 351

  Fly   217 GS-KLVGVSNFVSSN-GCQSGAPAGFQRVTYHLDWI 250
            |. .::||   :||. ||.:..|..:.||:.:||:|
  Fly   352 GMYTIMGV---ISSGFGCATVTPGLYTRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 74/269 (28%)
Tryp_SPc 37..253 CDD:238113 75/270 (28%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 74/269 (28%)
Tryp_SPc 144..387 CDD:238113 75/270 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436981
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.