DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG31220

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:232 Identity:58/232 - (25%)
Similarity:90/232 - (38%) Gaps:50/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNG---------------NFIKH 111
            ||||:|...:||||.||:.|....|........|.:.....:..|               :...|
  Fly   139 CGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSH 203

  Fly   112 SN---------ADIALIR----IPHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWG--GTYD- 160
            ::         .||||:|    :.:...::.:..::.|....::..|      ..|||  |.:| 
  Fly   204 NDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMY------VAGWGKTGMFDT 262

  Fly   161 GSPLPDWLQCVDLQIVHNEECGWTYG--SVGDNV-ICTRTVDGKSICGGDSGGPLVTHDGSK--- 219
            ||.:   |:...:::...|||...|.  ..|... ||...:|.:..|.||||.||:...|..   
  Fly   263 GSKV---LKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYET 324

  Fly   220 ---LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRDH 253
               |.|::::....| ..|.|:.|.|......|||.|
  Fly   325 ITFLAGITSYGGPCG-TIGWPSVFTRTAKFYKWIRAH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 54/227 (24%)
Tryp_SPc 37..253 CDD:238113 57/230 (25%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 54/227 (24%)
Tryp_SPc 104..360 CDD:238113 57/230 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.