DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and ctrb.1

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:265 Identity:87/265 - (32%)
Similarity:125/265 - (47%) Gaps:22/265 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGW-WCGGSII 67
            ||.||:......:|:.  ..:..:|.......||.||..|.....|:.|.|..|.|: :||||:|
Zfish     3 FLWILSCLAFFGAAYG--CGIPAIPPVVTGYARIVNGEEARPHSWPWQVSLQDSTGFHFCGGSLI 65

  Fly    68 AHDWVLTAEHCIGDAASVIVYFGATWRTNAQFTHTVGNGNFIKHS-------NADIALIRI--PH 123
            ..:||:||.||....:..::.......:||:...|:..|..|||.       |.||.||::  |.
Zfish    66 NENWVVTAAHCNVRTSHRVILGEHDRSSNAEAIQTIAVGKSIKHPNYNSFTINNDILLIKLATPA 130

  Fly   124 VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGT-YDGSPLPDWLQCVDLQIVHNEECGWTYG- 186
            ....| |:.|.|...||.:....:  .|..|||.| |:....|..||...|.::.|::|...:| 
Zfish   131 KINTH-VSPVCLAETNDNFPGGMK--CVTSGWGLTRYNAPDTPALLQQAALPLLTNDDCKRYWGT 192

  Fly   187 SVGDNVICTRTVDGKSICGGDSGGPLVTHDGS--KLVGVSNFVSSNGCQSGAPAGFQRVTYHLDW 249
            ::.|.:||. ...|.|.|.||||||||..:..  .|||:.::.||. |.:..||.:.|||....|
Zfish   193 NITDLMICA-GASGVSSCMGDSGGPLVCENNRVWTLVGIVSWGSST-CSTSTPAVYARVTKLRAW 255

  Fly   250 IRDHT 254
            : |.|
Zfish   256 V-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 78/227 (34%)
Tryp_SPc 37..253 CDD:238113 78/229 (34%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 78/227 (34%)
Tryp_SPc 34..259 CDD:238113 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.