DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG31205

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:262 Identity:63/262 - (24%)
Similarity:98/262 - (37%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FDEKVFVKD--------LPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLT 74
            |:||.:..|        .|...:|.|...:|                |....|.|.:|....|:|
  Fly    32 FNEKQYNSDNIIAEPTEHPWVVRIVGVTKDG----------------SNTLLCTGILIDSRRVVT 80

  Fly    75 AEHCIGDAASVIVY---FGATWRTNAQFTH--TVGNGNFIKHSNADIALIRI-PHVDFWHMVNKV 133
            |.||:....|..:|   ||.:..:|.....  ||......:....|:|:|.: ..|.|..:|..:
  Fly    81 AAHCVSKDESESIYGVVFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPI 145

  Fly   134 ELPSYNDRY---NNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQI------VHNEECGWTYGSVG 189
            .|||.::..   ...|....||...|.::|..  ....|.:|.:|      :.::||........
  Fly   146 CLPSVSEMVPGSETSNSKLIVAGLEGPSFDRR--HSATQRLDKRIKMTYTKIDSKECHEKQARFP 208

  Fly   190 DNVICTRT----VDGKSICGGDSGGPLVTHDGSKLVG--VSNFVSSNGCQSGAPAGFQRVTYHLD 248
            :.:||..|    :.|.::... ||.|...|    |:|  |:.|.||:....    |:..:..|||
  Fly   209 EELICGHTERSPLSGSALTEA-SGTPRQFH----LLGIAVAGFFSSDLDHQ----GYLNIRPHLD 264

  Fly   249 WI 250
            ||
  Fly   265 WI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 54/234 (23%)
Tryp_SPc 37..253 CDD:238113 56/235 (24%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.