DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG11664

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:261 Identity:59/261 - (22%)
Similarity:99/261 - (37%) Gaps:48/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAH 69
            |.:||:||....|..     :.:|...:..|.:...| .|:              :...||:.:.
  Fly    10 LILLAIAVRWGDALH-----RGIPVQQQNYGYVMQIY-GPQ--------------FLAAGSLFSA 54

  Fly    70 DWVLTAEHCI-----GDAASVIV-YFGATWRTNAQFTHTVGNGNFIKHS-------NADIALIRI 121
            .:|||..||.     .:..||.. |....|....:..     ...::|.       ..|||::|:
  Fly    55 RYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFRGKQV-----AGLLRHPKFSPLTLRNDIAVLRV 114

  Fly   122 -PHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTY 185
             ..:...||:|.:.|.|......|.........||...:...|    |:.:.:|:...:.|...:
  Fly   115 KAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLMHIAQP----LKSMSVQVEPEKNCRQWF 175

  Fly   186 GSVGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGC-QSGAPAGFQRVTYHLDW 249
            ..:...|||.....|:.:|.||||.||::  |.::.|::  ::...| ....||.|..|.||..:
  Fly   176 PQISGGVICASATMGEGLCYGDSGDPLIS--GGEVCGLA--IAFRKCGDKRYPALFTDVHYHRAF 236

  Fly   250 I 250
            |
  Fly   237 I 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 50/228 (22%)
Tryp_SPc 37..253 CDD:238113 51/229 (22%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 51/228 (22%)
Tryp_SPc 38..237 CDD:214473 50/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.