DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Tpsb2

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:287 Identity:88/287 - (30%)
Similarity:120/287 - (41%) Gaps:58/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWW---C 62
            |...|.:|||:..::       .|...|...|....|..|..|.|.|.|:.|.|.|...:|   |
  Rat     1 MLKLLLLLALSPLAS-------LVHAAPCPVKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFC 58

  Fly    63 GGSIIAHDWVLTAEHCIG-----------DAASVIVYFGATWRT-NAQFTH----TVGNGNFIKH 111
            |||:|...|||||.||:|           ......:|:.....| |....|    ||.:|     
  Rat    59 GGSLIHPQWVLTAAHCVGLHIKSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDG----- 118

  Fly   112 SNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPL--PDWLQCVDL 173
              |||||:.:.: |:....::...||..::.:.:....|..  |||......||  |..|:.|.:
  Rat   119 --ADIALLELENPVNVSTHIHPTSLPPASETFPSGTSCWVT--GWGDIDSDEPLLPPYPLKQVKV 179

  Fly   174 QIVHNEECGWTYGS----------VGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGV---SN 225
            .||.|..|...|.:          |.|.::|.......| |.||||||||    .|:.|.   :.
  Rat   180 PIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAGNTRSDS-CQGDSGGPLV----CKVKGTWLQAG 239

  Fly   226 FVS-SNGC-QSGAPAGFQRVTYHLDWI 250
            .|| ..|| ::..|..:.||||:||||
  Rat   240 VVSWGEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 78/250 (31%)
Tryp_SPc 37..253 CDD:238113 80/251 (32%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 80/251 (32%)
Tryp_SPc 30..266 CDD:214473 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.