DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Mcpt2

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:272 Identity:74/272 - (27%)
Similarity:109/272 - (40%) Gaps:55/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFLAILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTV--------GLGFS 57
            |:..|.::||.:.|.:..:|                |..|..:.....||..        ||...
  Rat     1 MQALLFLMALLLPSGAGAEE----------------IIGGVESIPHSRPYMAHLDIVTEKGLRVI 49

  Fly    58 GGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFGA-----------TWRTNAQFTHTVGNGNFIKH 111
                |||.:|:..:||||.||.|...:||:  ||           ..:...|..|...|.....|
  Rat    50 ----CGGFLISRQFVLTAAHCKGREITVIL--GAHDVRKRESTQQKIKVEKQIIHESYNSVPNLH 108

  Fly   112 SNADIALIRI-PHVDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQI 175
               ||.|::: ..|:....||.|.|||.:|..:.....|  |.|||.|....|....|:.|:|:|
  Rat   109 ---DIMLLKLEKKVELTPAVNVVPLPSPSDFIHPGAMCW--AAGWGKTGVRDPTSYTLREVELRI 168

  Fly   176 VHNEEC-GWTYGSVGDNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNG-CQSGAPA 238
            :..:.| .:.|......|........::...|||||||:      ..||::.:.|.| ..:..||
  Rat   169 MDEKACVDYRYYEYKFQVCVGSPTTLRAAFMGDSGGPLL------CAGVAHGIVSYGHPDAKPPA 227

  Fly   239 GFQRVTYHLDWI 250
            .|.||:.::.||
  Rat   228 IFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 66/235 (28%)
Tryp_SPc 37..253 CDD:238113 68/236 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 67/251 (27%)
Tryp_SPc 21..242 CDD:238113 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.