DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Prss30

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:243 Identity:72/243 - (29%)
Similarity:103/243 - (42%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GRITNGYAAPEGKAPYTVGLGF-SGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYF----GATWR 94
            |:|..|..||||:.|:.|.|.. ..|..||||:|...|||||.||.....:...|.    |.|..
  Rat    29 GKIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLS 93

  Fly    95 TNAQFTHTVGNGNFIKH--------SNADIALIRIPHVDFWHMVNKVELPSYNDRYNNYNEWWAV 151
            .....:..|...|...:        |:.||||:|:.........:.|.||............|..
  Rat    94 LTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPLQPSQFSPVCLPQAQAPLTPGTVCWVT 158

  Fly   152 ACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGSVGD-----------NVICTRTVDG-KSIC 204
              |||.|:: ..|...||.:.:.::.:|:|...| .:|:           :::|...|:| |..|
  Rat   159 --GWGATHE-RELASVLQELAVPLLDSEDCERMY-HIGETSLSGKRVIQSDMLCAGFVEGQKDSC 219

  Fly   205 GGDSGGPLVTHDGSKLVGVSNFVSSNGC-QSGAPAGFQRVTYHLDWIR 251
            .||||||||....|..:.|.......|| :...|..:.||..::|||:
  Rat   220 QGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 69/239 (29%)
Tryp_SPc 37..253 CDD:238113 71/241 (29%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.