DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG18636

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:257 Identity:71/257 - (27%)
Similarity:109/257 - (42%) Gaps:64/257 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RITNGYAAPEGKAPYTVGLGFSGGWW-CGGSIIAHDWVLTAEHCIGDAASVIVYFGATWRT---- 95
            ||.||:.|....:|:.|.|..:...: ||||:|....||||.||......::...|...||    
  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108

  Fly    96 --------------NAQFTHTVGNGNFIKHSNADIALIRI-----------PHVDFW-----HMV 130
                          :|.|.|.:.:.|  .|:| |||::|:           |....|     |.:
  Fly   109 CTGYYCNFREEHMVDAGFKHKLYDPN--THAN-DIAILRLSKSVVYRDNIRPICVVWDHRWRHYL 170

  Fly   131 NKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYG-SVGDNVIC 194
            :|::|              ..|.|||.|...|. .|.||.:|::....:.|....| ::..|..|
  Fly   171 DKIDL--------------LTATGWGKTQMESD-SDALQTLDIRRQPPDVCAKFIGQTIAGNQFC 220

  Fly   195 TRTVDGKSICGGDSGGPL---VTHDGSK---LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250
            ....| .::|.|||||||   :||..::   .||::::.:.| ||..:.  |..|..|.::|
  Fly   221 AGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRN-CQKASV--FTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 70/255 (27%)
Tryp_SPc 37..253 CDD:238113 70/256 (27%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/255 (27%)
Tryp_SPc 45..278 CDD:238113 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.