DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and CG33462

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:236 Identity:52/236 - (22%)
Similarity:90/236 - (38%) Gaps:46/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFG-------------------ATWR 94
            |:...|....|:.|.|::|.|.:||||.||:.|...:.|..|                   ..:.
  Fly    48 PWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYN 112

  Fly    95 TNAQFTHTVGNGNFIKHSNADIALIRI-PHVDFWHMVNKVELPSYNDRYNNYNE-----WWAVAC 153
            .:..|.|...|.|   ....||.::|: ..|::.:.:..:.:.:    .|.:.|     .|....
  Fly   113 VDMGFRHRYYNAN---DQTNDIGMLRLGRRVEYLNHIRPICIFA----SNRFQEPIDQLTWFTTT 170

  Fly   154 GWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYG-SVGDNVICT-RTVDGKSICGGDSGGPLVT-- 214
            .|..| ..:.....|:.:::.....|.|...|| ::....||. .|:  ..:|..|||.|.:.  
  Fly   171 VWRET-AANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTL--SQLCSTDSGAPQIRKM 232

  Fly   215 -HDGSK---LVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIR 251
             |:||.   .:|:::.|......||.   ...:..:.|||:
  Fly   233 WHNGSDRYVQLGIASRVKGQCQNSGI---LMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 50/233 (21%)
Tryp_SPc 37..253 CDD:238113 52/236 (22%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 52/236 (22%)
Tryp_SPc 48..269 CDD:214473 50/233 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435811
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.