DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and Sp212

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:268 Identity:65/268 - (24%)
Similarity:93/268 - (34%) Gaps:81/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ITNGYAAPEGKAPY--------TVGLGFSGGWWCGGSIIAHDWVLTAEHCI-------------- 79
            |..|...|.|:.|:        ...|.|.    |.||:|:...|::|.||:              
  Fly   277 IVRGNEFPRGQYPWLSAVYHKEVRALAFK----CRGSLISSSIVISAAHCVHRMTEDRVVVGLGR 337

  Fly    80 -------GDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSNADIALIRIPHVDFWHMVNKVELP- 136
                   .|.|.:.......|..:.         |...:|:||||||.|            |.| 
  Fly   338 YDLDDYGEDGAEMRNVMRLLWHPDY---------NTRSYSDADIALITI------------ERPV 381

  Fly   137 SYNDRYNNYNEWWAVA----------CGWGGTYDGSPLPDWLQCVDLQIVHNEECG--WTYGSVG 189
            ::||.......|...|          .|||...|.| ...:.:.|:.:|.....|.  |....|.
  Fly   382 TFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSS-RTQYPRVVEAEIASPTVCASTWRGTMVT 445

  Fly   190 DNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGF----QRVTY----- 245
            :..:|....||...|.|||||.|:...|.:.: :...||:.   ...|||.    |.|.|     
  Fly   446 ERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWL-LRGIVSAG---ERGPAGTCQLNQYVLYCDLSK 506

  Fly   246 HLDWIRDH 253
            |::||.::
  Fly   507 HINWISEN 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 63/263 (24%)
Tryp_SPc 37..253 CDD:238113 65/266 (24%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 65/266 (24%)
Tryp_SPc 277..511 CDD:214473 63/263 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.