DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Biii and PRSS33

DIOPT Version :9

Sequence 1:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:283 Identity:80/283 - (28%)
Similarity:110/283 - (38%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASAFDEKVFVKDLPKATKIEGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDW 71
            :|.|.:.:|.....|......|   ::..||..|....:|:.|:...:...|...||||:||..|
Human    10 LLLLVLGAAGTQGRKSAACGQP---RMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQW 71

  Fly    72 VLTAEHCIGDAASVIVY---FGATWRTNAQFTHTVG--------------NGNFIKHSNADIALI 119
            ||||.||....|....|   .||. |..:....|:.              :|     :..|:||:
Human    72 VLTAAHCFPRRALPAEYRVRLGAL-RLGSTSPRTLSVPVRRVLLPPDYSEDG-----ARGDLALL 130

  Fly   120 RIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVAC---GWGGTYDGSPLPDW--LQCVDLQIVHN 178
            ::.. |.....|..|.||....|...     ...|   |||....|.|||:|  ||.|.:.::.:
Human   131 QLRRPVPLSARVQPVCLPVPGARPPP-----GTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDS 190

  Fly   179 EECGWTYGSVGDNV-----------ICTRTVDG-KSICGGDSGGPLV-THDGS-KLVGVSNFVSS 229
            ..|...| .||.:|           :|.....| |..|.|||||||. ...|| .||||.::  .
Human   191 RTCDGLY-HVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSW--G 252

  Fly   230 NGCQ-SGAPAGFQRVTYHLDWIR 251
            .||. ...|..:..|..:..||:
Human   253 KGCALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 73/251 (29%)
Tryp_SPc 37..253 CDD:238113 74/253 (29%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.